Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP (By similarity).

Belongs to the Rho GDI family.

225 amino acids

MLGLDACELGAQLLELLRLALCARVLLTDKEGGQLPPEEALDEAVPEYRAPGKKSLLEIQQLDPDDESLVKYKRALLGPVLPAVDPSLPNVQVTRLTLISEQAPGPIVMDLTGELAALKNQVFVLKEGVDYKVKITFKVNKEIVSGLKCLHHTYRHGLRVDKAVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGAYVVTSFFTDDDRTAHLSWEWGLYVCQDWER

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARHGDIG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here