RTD-1 and RTD-3 have similar antimicrobial activities against the Gram-positive bacteria S.aureus 502A and L.monocytogenes, the Gram-negative bacteria S.typhimurium and E.coli ML35, and the fungi C.albicans 16820 and C.neoformans 271A.

Belongs to the alpha-defensin family. Theta subfamily.

76 amino acids

MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL

8.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RTD1A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here