About Products Protein Database Contact

Protein expression services for RARG | Retinoic acid receptor gamma

Description
Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (By similarity).
Family
Belongs to the nuclear hormone receptor family. NR1 subfamily.
Species
Notophthalmus viridescens
Length
505 amino acids
Sequence
MMKFSDTASCRDGGERPEEEGKGAGGRSKLRMGKEEFTGSVGKEEAAAVASMSSSKDRICSTSTQLSQLHGFPPSMYPFAFSSNMRGSPPFDLTNGGAYFRSFPTDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEIKEEVVTDSYEMPPEMEALIQKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWHKFSELATKCIIKIVEFAKRLPGFATLTIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAEQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIYARRRRPNKPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEAFEDDASPPPKSEQKPIKVEEKPGEKTSTKDP
Mass
56.6 kDa
Simulated SDS-PAGE
Western blot of RARG recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make RARG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here