Catalyzes the oxidation of the 1,2-dihydro- and 1,6-dihydro- isomeric forms of beta-NAD(P) back to beta-NAD(P)+. Has a preference for 1,2-dihydro-beta-NAD as substrate. May serve to protect primary metabolism dehydrogenases from inhibition by the 1,2-dihydro- and 1,6-dihydro-beta-NAD(P) isomers.

Belongs to the bacterial renalase family.

328 amino acids

MTVPIAIIGTGIAGLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYFTARDRRFATAVKQWQAQGHVAEWTPLLYNFHAGRLSPSPDEQVRWVGKPGMSAITRAMRGDMPVSFSCRITEVFRGEEHWNLLDAEGQNHGPFSHVIIATPAPQASTLLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPERDDTLDTWILHATSQWSRQNLDASREQVIEHLHGAFAELIDCTMPAPVFSLAHRWLYARPAGAHEWGALSDADLGIYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQ

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PSPTO_1126 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here