Inhibitor of the DOA4 deubiquitinase involved in the regulation of protein degradation by the proteasome and maintenance of a normal level of free ubiquitin.

Belongs to the RFU1 family.

189 amino acids

MKSSSHLKQEALNYRFNSNVPLKLYLTTCISIVEEAQNSARCNNMERAYLLYIRYLDLCLNRLVHHSEVNTSVESLYKREYFQLLKLEVPAIMKITEELKIKIDARYKSLANNVATSTYVRSPAVMTTNPSDEINLPSSFDEQKFNQSISWFNHSSKHFSAQSDSNNEYPELPELNATSTSVTYTMPAL

21.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RFU1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here