Component of a cytoskeletal structure that is required for the formation of endocytic vesicles at the plasma membrane level. Plays an important role in virulence.

264 amino acids

MSWGGFKKAINRAGASVIVKDVDKTMDKDFDVEERRYKTLKTAGTNLQKAAKGYLDNIRAITNSQVTIAEIIYNLYEESKQGQSLYSNVGTYYMQSVKEFDEETVKQIDGPYRETVLDPIGKFSNYFSEIDEAIKKRAHKKIDYEQCKAKVRRLVDKPAKDAAKLPRAEKELSMAKEIYDELNDQLKAELPQLIALRVPFYDPSFEALVKIQLRFCTEGYSRLAQIQQYLDPASRDEYANGLLDGKIDDMLAQMQGLSITSLGK

30.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RVS161 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here