Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis. In late stages of cytokinesis, upon completion of the bridge formation between dividing cells, mediates exocyst recruitment to the midbody to drive abscission (By similarity). Regulates the actin cytoskeleton to play a role in gastrulation or neurulation. During the cleavage stages, the GTP-bound form induces a cortical reaction that affects the localization of pigment granules. Activated by the FGF pathway via ras and ral-GDS, but independently of raf. Directs ralbp1 to the plasma membrane (By similarity).

Belongs to the small GTPase superfamily. Ras family.

206 amino acids

MAANKNKNQSSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEDRRQVPMDEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREVRTKKMSENKDKNGKKSGKSKKGFKQRCCLL

23.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ralb-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here