Description
Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity). Regulates negatively brassinolide (BL)-mediated signaling pathway (e.g. BL-induced hypocotyl elongation and branching limitation) (PubMed:19473327).
Family
Belongs to the plant rapid alkalinization factor (RALF) family.
Species
Arabidopsis thaliana
Sequence
MRGLSRNSGAAAIFAILLILAVHNWSVAVSSQSTEFAGDFPPFETECRGTIAECSVSAALGDGGDLFYGGGEMGEEFEMDSEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCSAITRCRRS
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service