Stimulates the GTPase activity in the presence of RNA1. May potentiate the action of RanGAP1 (RNA1), thus playing the role of a negative regulator.

Belongs to the RANBP1 family.

215 amino acids

MSAEQEKKTQGTTKEEQKSSFASEDVASKQTEEAKAVFGDGVAKQENKSGASTNDEKKPAEGDEDAEPASPEVHFEPIVKLSAVETKTNEEEETVEFKMRAKLFRFDKAASEWKERGTGDARLLKHKETGKTRLVMRRDKTLKVCANHLLMPEMKLTPNVGSDRSWVWTVAADVSEGEPTAETFAIRFANSENANLFKENFEKYQEENAKILKKN

24.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sbp1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here