About Products Protein Database Contact

Protein expression services for Rbck1 | RanBP-type and C3HC4-type zinc finger-containing protein 1

Description
E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteasome. Component of the LUBAC complex which conjugates linear ('Met-1'-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis. Binds polyubiquitin of different linkage types (By similarity).
Family
Belongs to the RBR family.
Species
Mus musculus
Length
508 amino acids
Sequence
MDEKTKKAEEMALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Mass
57.5 kDa
Simulated SDS-PAGE
Western blot of Rbck1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Rbck1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here