Regulator of the TOR pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. May activate the TOR signaling cascade in response to amino acids (By similarity).

Belongs to the LAMTOR3 family.

132 amino acids

MEKVDEFLEYIKVSILDKSIVDTSLILSDRDGFVLGKIIDKSSSADNVIDNSLISTFSSATDQASKLHAGNNKSIVSFFEDRIIVHINVSNVILSIITDTESNVGLILGSQDDLIRSLTSLSNSIQSDIQDM

14.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DDB_G0274833 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here