Rab GTPase effector involved in the late steps of regulated exocytosis, both in endocrine and exocrine cells.

292 amino acids

MADTIFGSGCDQWVCPNDRQLALRAKLHTGWSVHTYQTEKQRKSQSLSPAEVEAILQVIQRAERLDILEQQRVGRLVERLETMRRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKKVCTKCGIEASPSQKRPLWLCKICSEQREVWKRSGAWFYKGIPKFILPLKIPGQADHPSFRPLPVEPAEQEPRSTETSRVYTWARGRVVSSDSDSDSDLSSSSLDDRLRPAGVRDPKGNKPWGESGGSVESLKMGPTRPASCLSGSQSSLASETGTGSADPQGGPRTLAGPRGPR

32 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RPH3AL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here