Essential regulator of plant defense, which plays a central role in resistance in case of infection by a pathogen. It is a common target for both type III avirulence proteins from P.syringae (AvrB, AvrRpm1 and AvrRpt2) and for the plant Resistance (R) proteins RPM1 and RPS2. In strains carrying the appropriate R gene for avirulence proteins of the pathogen, its association with avirulence proteins triggers a defense system including the hypersensitive response, which limits the spread of disease. In contrast, in plants lacking appropriate R genes, its association with avirulence proteins of the pathogen impairs the defense system and leads to the pathogen multiplication.

Belongs to the RIN4 family.

211 amino acids

MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSSRTKPEQVDTVRRSREHMRSREESELKQFGDAGGSSNEAANKRQGRASQNNSYDNKSPLHKNSYDGTGKSRPKPTNLRADESPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSGANVSGSSRTPTHQSSRNPNNTSSCCCFGFGGK

23.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RIN4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here