Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Putative component of the spliceosome which enhances the formation of the ATP-dependent A complex of the spliceosome. May participate in mRNA 3'-end cleavage. Also mediates increase of mRNA abundance and translational efficiency (By similarity).

Belongs to the splicing factor SR family.

283 amino acids

MAPSPTKRRERSEDKPRERGKEKAPAKEGAEKERGRDKIRKRRSNSTGSSSSRSSSSSSSSSGSSSGSSSGSSSSSGSSRSGSSSSSRSSSSSGSSGSPSPSRRRHDNRRRSRSKSKSQKRTDEKERKRRSPSPKPTKLYLGRLTRNVTKDHIQEIFATYGKIKMIDMPSDRLHPNVSKGYAYVEYESPEDAQKALKHMDGGQIDGQEITATAILAQRIRPAPRRLSPPRRMPPPPPMWRRTPPRMRRRSRSPRRRSPVRRRSRSRSPGRRRHRSRSSSNSSR

31.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rnps1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here