Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage (By similarity). Catalyzes the hydrolysis of diadenosine tetra-, penta-, or hexa-phosphate with the departure of ATP as leaving group. Preferred substrate is Ap4A. Also acts on diguanosine tetra- and penta-phosphate at a lesser extent. Required with IalB for erythrocytes invasion.

Belongs to the Nudix hydrolase family. RppH subfamily.

170 amino acids

MDTMVDFKTLPYRKGVGIVVFNREGQVWIGRRLITSSHTYAEVSKLWQFPQGGIDEGEEPLDAARRELYEETGMRSVNLIKEVQDWFCYDFPQELIGHVLNNQYRGQMQKWFAFQFIGETSEIVINSPENSNKAEFDQWKWINLEVLPSIVVSFKRHVYMKVVHEFRNII

20.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rppH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here