Master regulator of 5'-end-dependent mRNA decay (PubMed:18202662). Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage (PubMed:18202662). Preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products (PubMed:11479323). Also able to hydrolyze diadenosine hexa- and tetra-phosphate (PubMed:11479323). Has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose (PubMed:11479323). In an RNase PH (rph) wild-type strain background, RppH is not required for maturation of tRNAs; however, strains with the truncated rph allele (for example K12 W1485 and its derivatives MG1655 and W3110) require RppH for maturation of certain monocistronic tRNAs with short (<5 nucleotides) leader sequences (PubMed:28808133). In the meningitis causing strain E.coli K1, has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro (PubMed:10760174).

Belongs to the Nudix hydrolase family. RppH subfamily.

176 amino acids

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

20.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rppH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here