Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is essential for late-stage differentiation of M.xanthus.

Belongs to the sigma-70 factor family.

246 amino acids

MVTANLRFVVKVAYEYRSYGIKMSDLIQEGNIGLMKAVQKFDPDKGIRLISYAVWWIRAYIQNYILKSWSLVKLGTTQAHGKLFFSLARTRRELEKFGSGDAAVNVDDIARRLHVKPGEVREMEQRMGGRDLSLDAPMGEDGGNSHVDFVVSAAAPQDDEFADKEEAGLINARVRAALMRLDPREPFIIEQRVMNERPMTLKELGEHFGFSRERARQLEIRAKDKLKSELAALMAEVDPEAVAAQQ

27.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sigB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here