CnrH alone is able to activate CNR expression, while both CnrY and CrnX are needed for nickel induction of cnrH (PubMed:10671463). Binds DNA in an RNA polymerase-dependent fashion (PubMed:10671464). CnrH may be controlled by a CnrYX transmembrane anti-sigma factor complex which binds CnrH in the absence of Ni(2+). If Ni(2+) appears in the periplasm, it may be bound by CnrR (CnrX); the signal then would be transmitted by CnrY into the cytoplasm and CnrH would be released.

Belongs to the sigma-70 factor family. ECF subfamily.

191 amino acids

MNPEDADRILAAQAASGNQRAFGQLVARHGVALAQAARSFGIPETDVDDVVQDTFVAAWHALDDFDPDRPFRAWLFRIGLNKMRDLYRFRRVRQFLFGAENLGDLELAGGVANDEPGPEQQVAARLELARVASTLGKLDTGSREVIVLTAIVGMSQPEAAAVLGLSVKAVEGRIGRARAKLSALLDADSEK

20.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cnrH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here