Protein expression services for SSU72 | RNA polymerase II subunit A C-terminal domain phosphatase SSU72
Description
Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. SSU72 is required for 3'-end formation of snoRNAs (By similarity).
Family
Belongs to the SSU72 phosphatase family.
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Length
257 amino acids
Sequence
METANGNAGSAATAQNGQQEDASGFKLKFCTVCASNQNRSMEGHLRLAQANYPVISFGTGSLVRLPGPTITQPNVYKFNETSYDSIYRELEAKDPRLYRANGLLNMLGRNRVIKWGPERWQDWQVGMPRVKHEKDQGSIGMEAGVPDIVITCEERCWDAVVDDLLNRGSPLNRPVHVINIDIKDNHQDASIGGGAMVDLADSLNRAAMEERDKVGAAVFDAGGAASRASFDERVPEVLGEWQERWPGLPSTWTLSWF
Mass
28.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SSU72 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here