Protein expression services for narya | RING finger protein narya
Description
Required for the formation of DNA double-strand breaks (DSBs) together with nenya and vilya during the meiotic recombination process (PubMed:30615609). Plays a role in DSBs processing into crossovers (PubMed:30615609). Plays a redundant role with nenya in chromosome segregation during female meiosis (PubMed:30615609).
Species
Drosophila melanogaster
Length
211 amino acids
Sequence
MFRVHCNKCFRHRKTDPAVPFHLTQCRHVICGPCLGQSSLEKNCPLCGQVLKAIQINRDMPTSVANYFADPLRFQQIYRKISKFQADQRASDNLGFYRQLQQLEQNKRQLEGFCKMEAQLNQKVVEEKKRIAELRTYIAYHENAQRMTRRRHSAGERFHTPEFKEAWNTSISTSDKSPSDMPSDSSRRSADLDTQSTRRRSFGSDTKGFRL
Mass
24.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make narya using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here