Plays a role in the regulation of cell shape and polarity. Plays a role in cellular protein transport, including protein transport away from primary cilia. Neuroprotective protein (By similarity).

Belongs to the RILPL family.

394 amino acids

MEGISALEKNVAELTVMDVYDIASAVGQEFERVIDQYGCEVIGRLMPKVVRVLEILEVLVSRNHINPEMEELRLELDRLRLERMDRIEKEKKHQKELELVEDVWRGEAQDLLNQIAQLQEENKQLVSNLSQKDINLTEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELVLKNEDVEALQQQQSRLMKINHDLRHRVTVVEAQGKALIEQKVELEAYLQTKEQEAASMRLEIGKLRDKLKGEQHTNGEEIKTETLNEESILETEKLSLDLKDSNRPRFTLQELRDVLHERNELKAKVFMLQEELAYYKSEEADEEHKLPQSSPVIDSKAPIPQESGIKRLFSFFSRDKKRMPMMQKNVHFQESFGQWTEYNRDDVYTEQGQEALQHM

46.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rilpl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here