Activation of pyruvate formate-lyase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.

Belongs to the organic radical-activating enzymes family.

251 amino acids

MLKGHLHSVESMGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKINEPSREVTVDEMVNEILPYKPYFEASGGGVTVSGGEPLLQMPFLEQLFKELKANGVHTCIDTSAGCVNDTPAFNRHFDELQKHTDLILLDIKHIDNDKHIKLTGKPNTHILKFARKLSDMKQPVWIRHVLVPGISDDKEDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKNLGIPYQLENVEPPDDEAVKEAYRYVNFNGKIPVTL

28.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make pflA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here