Description
Catalyzes the phosphorylation of D-fructose 6-phosphate, the first committing step of glycolysis. Uses inorganic phosphate (PPi) as phosphoryl donor instead of ATP like common ATP-dependent phosphofructokinases (ATP-PFKs), which renders the reaction reversible, and can thus function both in glycolysis and gluconeogenesis. Consistently, PPi-PFK can replace the enzymes of both the forward (ATP-PFK) and reverse (fructose-bisphosphatase (FBPase)) reactions.
Family
Belongs to the phosphofructokinase type A (PFKA) family. PPi-dependent PFK group II subfamily. Clade P sub-subfamily.
Species
Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z)
Sequence
MNKPKKVAILTAGGLAPCLSSAIGSLIERYTEIDPSIEIICYRSGYKGLLLGDSYAVTPKIRENAALLHKFGGSPIGNSRVKLTNVKDCIKRGLVQEGQDPQKVAADQLVKDGVDVLHTIGGDDTNTAAADLAAFLAKNDYGLTVIGLPKTIDNDVFPIKQSLGAWTAAEQGAQYFQNVVAEYNANPRMLIVHEVMGRNCGWLTAATAMEYRKLLDRSEWLPEIGLDRAAYEVHGVFVPEMEIDLAAEAKRLREVMDKVDCVNIFVSEGAGVDAIVAEMQAKGQEVPRDAFGHIKLDAVNPGKWFGEQFAEMIGAEKTLIQKSGYFARASASNVDDIRLIKSCADLAVECAFRRESGVIGHDEDNGNVLRAIEFPRIKGGKPFDIDTPWFVQMLAGIGQSKGARVEVSH
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service