Catalyzes the oxidation of various aldopyranoses and disaccharides on carbon-2 to the corresponding 2-keto sugars concomitant with the reduction of O(2) to H(2)O(2). Plays an important role in lignin degradation of wood rot fungi by supplying the essential cosubstrate H(2)O(2) for the ligninolytic peroxidases, lignin peroxidase and manganese-dependent peroxidase (By similarity).

Belongs to the GMC oxidoreductase family.

622 amino acids

MSTSSSDPFYNFAKTSFKSAAAQKASATSLPPLPGPDQKVPGMDIKYDVVIVGSGPIGCTYARELVEAGYKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVIQGQLMSVSVPVNKLVVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMSTHWTCATPRFDREQRPLLVKDDPDADDAIWDQLYTKAESYFKTGTDQFNESIRHNLVLNKLAEEYKGQRTFQQIPLAATRRNPTFVEWSSANTVFDLQNRPNIDAPEERFNLFPAVACERVMRNASNTAIESLHIRDLISGDRFAIQADVYVLTAGAVHNTQLLVNSGFGKLGRPDPANPPELLPFLGSYITEQSLVFCQTVMSTELIDSVKSDMTIIGNPGELGYSVSYMPGASTNKHPDWWNEKVQNHMMQHQEDPLPIPFEDPEPQVTTLFQPSHPWHTQIHRDAFSYGAVQQSIDSRLIVDWRFFGRTEPKEENKLWFSDKITDAYNMPQPTFDFRFPAGRTSQEAEDMMTDMCVMSAKIGGFLPGSLPQFMEPGLVLHLGGTHRMGFDEQEDNCCVDTDSRVFGFNNLFLGGCGNIPTAYGANPTLTAMSLAIKSCEYIKKNFTPSPFTPAQ

69.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make p2ox using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here