Belongs to the pterin-4-alpha-carbinolamine dehydratase family.

107 amino acids

MTGLDRERIVDGAPALSAEELQAALAGLPGWQLAGDGKSICREWRFKNFKQAAQLANLAAWQAEAAGHHPDIAFGWGHARVSYSTHSAGGVSRNDLIMAARLDAATG

11.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Pden_1985 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here