Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA.

Belongs to the YqgF nuclease family.

164 amino acids

MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRTVIRRVKFAIDAQALLDFAQSEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNMEQKTALPFVYWDERLSTVAAERTLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDGDEFSA

17.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RL2073 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here