Might function as a decapping enzyme required for the removal of the 5'-end m7GpppN cap tethered to viral and host mRNAs to allow their decay in cells. In addition to the mRNA cap, probably also efficiently hydrolyzes diphosphoinositol polyphosphates (By similarity).

Belongs to the Nudix hydrolase family. DIPP subfamily.

360 amino acids

MEYETNFRKKHICSNCGRSGHEFRNCIEPITSYGIINVCISDEYNESMIIKDKFCTKKNTYYRVSSRKHPEISCFISNHIRVRDHENMYKLDNEMIPYRSNEDIHKFCYYKNRILFMMVSRRFSLGFIEFIRGKYDVSDTKSIINLFQHMYEHEIKFINKNRYKYDNILYHFLNRNNEPKKIVLNRIYEGKYSNEYCEAKIKFNMLLNSSNEENNNIPVYLEFYIKHIKPKWKSPEWGFPKGRRDKRSEENMVCACREFEEETGYKKSDYSVLNKIEPIEEKLTGTNGVNYKHIYYLAINNCDINSDLTDYDTYEIGEIKWFTYDEAMARIRPYHIEKKRILTRVYLFILNYLIHNINNT

43.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MIMI_L375 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here