Probably responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (By similarity). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (By similarity). Histone deacetylases act via the formation of large multiprotein complexes (By similarity). As a likely component of a histone deacetylase complex, together with saeg-1 and hda-2, functions downstream of the cAMP-dependent kinase egl-4 to regulate the expression of genes required for egg-laying and forgaging (PubMed:21573134).

Belongs to the histone deacetylase family. HD type 1 subfamily.

507 amino acids

MSSDKFKLDTLFDDNDEIIEPDGADVKKRNVAYYYHKDVGHFHYGQLHPMKPQRLVVCNDLVVSYEMPKYMTVVESPKLDAADISVFHTEDYVNFLQTVTPKLGLTMPDDVLRQFNIGEDCPIFAGLWDYCTLYAGGSVEGARRLNHKMNDIVINWPGGLHHAKKSEASGFCYVNDIVLGILELLKYHKRVLYIDIDIHHGDGVQEAFNNSDRVMTVSFHRFGQYFPGSGSIMDKGVGPGKYFAINVPLMAAIRDEPYLKLFESVISGVEENFNPEAIVLQCGSDSLCEDRLGQFALSFNAHARAVKYVKSLGKPLMVLGGGGYTLRNVARCWALETGVILGLRMDDEIPGTSLYSHYFTPRLLRPNLVPKMNDANSAAYLASIEKETLACLRMIRGAPSVQMQNIVGIRLDEIEQIEENERLQKSSKSSIEYEVGKVSEKMEEECFVEEDSKPPSFPPGQDPRRIGQYWGYDRSGLAPPRSHSDVIEEAKYEDRDRRKDLNIPGIP

57.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hda-2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here