Repressor of the gat operon for galacticol transport and metabolism. In K12 strains the operon is constitutively expressed because this gene is inactive (PubMed:7772602).

112 amino acids

MTMNSFERRNKIIQLVNEQGTVLVQDLAGVFAASEATIRADLRFLEQKGVVTRFHGGAAKIMSGNSETETQEVGFKERFQLASAPKNRIAQAAVKMIHEGMTDPTHVIWTQA

12.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gatR using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here