Potential cysteine protease, which may play a central role after invasion of host cell.

Belongs to the peptidase C58 family.

261 amino acids

MHSPISGSFTSSTQVHDPIHPANSDGFRETLANVELRTKSPSAECPDKMGCCASKPQASDPNNPSTSSPARPSTSLFRYRTAELAQANADGICVGLTAEWLRNLNSHPSIRMEALVPGSQRHASATVRQKEYENLKVHLRRQGAGPSEADFAAQNTMLQKAGLAPSGKEKVYKVGEPNFPRMLTKITADGSNHLLSLYFAEGGAHTVATSAMDGNTTLFDPNFGEFTVQSDQIDDLFRSLANRYSNPNRQHLTTVTTQKMT

28.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NGR_a00490 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here