Involved in bacillithiol (BSH) biosynthesis. May catalyze the last step of the pathway, the addition of cysteine to glucosamine malate (GlcN-Mal) to generate BSH.

Belongs to the BshC family.

535 amino acids

MRYEEINLGYEKNLVRYYLTGYDRVAKFYHYNPWNTRSFYDRADYLKDKSNPEALYNLLSFYLKDFALDQKVVENLDKIKKGAFIVLTGQQPGFLTGPLYTIYKAVHAIIEAKRLSELLNHEVVPLFWIGSEDHDVEEVNFLYFPGKEGPQEIKIEFTDLRKIPAGLRPAEPETVEAIEKFEGLLPNFDYKEEVFTEIKKAYHSANLGQAFARLMLKLFGKFGLLVYDGLNPEFKRVTKGYLKNAFLKRDAIEKALFKVYTEQQSLGIEPQLDPCPNHCNMFIFKNDERIALEVAGEKVVSRDGEVSFTREEFLEFMERYPEKLSPNLVVRTSIQSLVFPVLAYVAGPGEIGYYGMLKEVYEIMGTQMPVILPRFTATLIEPRVEKALKEFALLPQEIYQDYDGVFHRVLERLDNLGIDDTFKALKESINSAYKNLQEKLAPLGADFQKLTGENLGRVMAQVKYLEERAQKYHREKNSKYIEKLWYLKTNFLPENEWQERVYNVFYYLAKYGFALIEKLLGIPFNPGKHYLLYLE

62.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bshC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here