Light-harvesting photosynthetic bile pigment-protein from the phycobiliprotein complex. Allophycocyanin has a maximum absorption at approximately 650 to 653 nanometers (By similarity).

Belongs to the phycobiliprotein family.

161 amino acids

MSLIIKSILNADAEARYFRPGELAQIKGFNASAASRLRLVQALTENRERIVKQSANQLFQKRPDIVSPGGNAYGQDMTATCLRDMDYYLRLITYSIVAGDSTPIQEIGVIGVREMYRSLGTPIEAVAESIRAMKYVATSMMSVEDRAEVDTYFDYLIGAMQ

17.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make apcA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here