Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates.

Belongs to the adenylate kinase family. AK6 subfamily.

181 amino acids

MIIVITGTPGVGKTTVSLLLSQRLGLEYLHVSTFVIERKLYRSYDELRSSFEIDDEEVAKELNRYLSERKNVVLETVYPSLVDNADKVVVLRKHPKVLYDELKKRGWNDIKVIENVEAEIIGYVAQEANEWFKETCEIDVTNLSPEEVVNRILGNICDKPVDWLDLPDVQDLLLALDKIIS

20.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Msed_2172 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here