Maybe involved in N-terminal acetylation of proteins. N-acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover.

288 amino acids

MMVPRISASPVFKRIFLRWGFVTLPIQKTVSHTLRRDFSAPCRSMVKCLLLRPGISVHSAQDRKFYSTEEKSSQFDENKSKSNNGKKNEPHGIKGLMAKYGYSALIVYILLTCVDLPLCFLGVHSLGEEKIKIYLNRGKQLIGMGEPDESKVIQDVRRKQAHREAVQAENADKVEDASRKTFNERWQEMKDSTLLAELLIAYGIHKSLIIVRVPLTAVLTPSFVKLLQRFGIDLMKKQKKVFQTMASGAKIRYKGNNPSDFIKNEGTALDITKRKPRTKGQKWFDGLM

32.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make NAT2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here