Probable enzyme that may play an important role in cell wall biology.

Belongs to the YkuD family.

165 amino acids

MFFHSVQQGETLSSIAADYRISLSHLIQANPTINPNQLFVGQSIVIPGLPNPNTIPYEIHVSLSQHQLTLLHNGSVVKIYPIAVGKMLTQTPTGNFVIVNKAPNPGGPFGTMWMSLSKLHYGIHGTNDPSSIGKSVSHGCIRMHNKDVEELAATVPIGTRVRIEP

17.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ABC3535 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here