Component of the DNA-dependent RNA polymerase that catalyzes the transcription in the cytoplasm of viral DNA into RNA using the four ribonucleoside triphosphates as substrates.

Belongs to the archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family.

205 amino acids

MAMQKLFTYIYEFIEYRKMVLLEEKVPYDKFVQMIFNTGFFRINAETLNHGIVSVFIFGANGKYVHHGGDMRTLLTNALNEKKQYEELILIVDKPILGKKNILDIIVEQRAANPTVVINIYPYHLFCINIPKVSAIPRHKLITQEEAQAFLGREYLQPQDLMQISASDPPVVWLGGRPGDFVQIERPSETAMHAVVIRYITKSKI

23.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ken-120 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here