Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate. Also contains a secondary oxaloacetate (OAA) decarboxylase activity due to the common pyruvate enolate transition state formed following C-C bond cleavage in the retro-aldol and decarboxylation reactions (By similarity).

Belongs to the class II aldolase/RraA-like family.

170 amino acids

MTTTVPFVTCDLLDDHTDKDIQVLTPSLDGRFFKSYGARKIFSGQIVTVKCFEDNSRVKELLATDGTGKVLVVDGGASMRCALMGDMIAESAVKYHWDGVVIYGCIRDVDALAELDLGIHALAAIPQKSNRQGIGEVGVNLYFGGVTFQAGCYIYADNNGIIVSKQKLID

18.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ACIAD1391 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here