Unknown. Resembles PsbF, one of the subunits of the photosystem II reaction center. However, it encodes asparagine rather than histidine at the site PsbF uses to bind heme.

Belongs to the PsbE/PsbF family.

96 amino acids

MVLKTLIVIAPILIAAFSTIFWLSYWGVFKWEDNQLGFENYQDWEDSGVIPENRPKGGYPVFTVRTLAVNALGIPTVFFLGAIFAMQFVRRGIFIA

10.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Pro_1494 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here