Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group.

Belongs to the UbiA prenyltransferase family. Protoheme IX farnesyltransferase subfamily.

303 amino acids

MSAQLTSRLRGYVQVTKPGIIMGNLISVAGGFLLAAQGNVDLTLMFATMIGLSLVVASGCAVNNCIDRDIDAKMQRTRNRVTVTGEISVQAVLSFGIGLGIIGFAMLAIFTNSLAVLFAAIGYVVYVGVYSLYMKRNSVYGTLVGSFSGAVPPVVGYCAVTGQMDMGAVILLLMFSLWQMPHSYAIAIFRFDDYAAANIPVLPVAQGMTKAKLHIVLYIAVFAVVSALLPLAGYTGIAFMAVTFATSLWWLAMALKGYRRDINLQSWARQVFGFSIITITALSVTMALDFQVVAQTPLLTLVP

32.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cyoE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here