About Products Protein Database Contact

Protein expression services for msrP | Protein-methionine-sulfoxide reductase catalytic subunit MsrP

Description
Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation. The catalytic subunit MsrP is non-stereospecific, being able to reduce both (R-) and (S-) diastereoisomers of methionine sulfoxide.
Family
Belongs to the MsrP family.
Species
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Length
318 amino acids
Sequence
MNRFTRYDVTPEAIFNQRRQIIKAMGLGAAALSLPNIGFAAEKSDQLKALNFKDAPKGDFLLTPENKVTGYNNFYEFGVDKASPAKFAKDFKTDPWSLEIAGEVENPFVLNHAQLFNTFPLEERIYRFRCVEAWSMVIPWVGFELARLVEMAKPTSKAKFVIFHTLHDPEQMPGQKNKFFGGGIDYPYVEALTIEEAMNPLTLLSVGLYGKMLPPQNGAPIRLVVPWKYGFKSIKSIVKITFSETRPRTTWEKLAPHEYGFYANVNPNVDHPRWSQASERVIGSGGLLAVKRQDTLMFNGYEKEVAHLYKGLDLKVNF
Mass
36.1 kDa
Simulated SDS-PAGE
Western blot of msrP recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make msrP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here