Description
Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.
Family
Belongs to the CheB family.
Species
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Sequence
MIRVLVVDDSAFMRNMITKFLTSNHEIAVAGTARNGEEALQKIKELRPDVITLDIEMPVMNGKETLKRIMASDPLPVVMVSSLTQQGADITIECLELGAIDFVAKPSGSISIDLYKVRDMLIEKVLTAGRVKLKGRQVPISKPAIETAKQPIVGGSDSVRFRAGKQLICIGTSTGGPRALQRVLPKLPKTLKAPVFIVQHMPKGFTASLANRLNHLSEVTVKEAENGERAKDGWVYIAPGGKNMAVGLEKGELVITLDDRDTESRHKPSVDYLFQSLASLREFEKIAVIMTGMGSDGTEGVKGLLKHGSGTVIAEAAESSVVFGMPKSVINNGLANDIKHVDEIAAAIMTYMKKERA
Simulated SDS-PAGE
![Western blot of cheB recombinant protein](/recombinant/cheB-37.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service