About Products Protein Database Contact

Protein expression services for cheB2 | Protein-glutamate methylesterase/protein-glutamine glutaminase 2

Description
Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.
Family
Belongs to the CheB family.
Species
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Length
356 amino acids
Sequence
MTIRALVVDDSALIRKVLSDILNEDPKIRVVGTAVNGKDGLEKVIKLRPDVVLLDNVMPVLDGLKTLARIMKEQPTPVVIVSALGERAEEITLTAFEYGAVDVIEKPSGILSQSMPEMAEEICRKVRTAPKANLKNLECMRDSEPLNPEKRETKENRVLKKAAPRNILAIGASTGGPRALEKLICSLPAELPAAVLVVQHMPPGFTASLSKRLDSKSALRVKEAQEGDRVEDGTVLIAPGNYHMEIVRNKVNSLEEETIHLSCGPKELGSRPSVNVLFRSIASVYGSRVISLVLTGMNCDGADGAEEIKKMGGKVIAEARSSCVVYGMPGEIVRRNLADLVLPLDKMAEEIIRIIG
Mass
38.6 kDa
Simulated SDS-PAGE
Western blot of cheB2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cheB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here