About Products Protein Database Contact

Protein expression services for rasp | Protein-cysteine N-palmitoyltransferase Rasp

Description
Required in hedgehog (hh) expressing cells for production of appropriate signaling activity in embryos and in the imaginal precursors of adult tissues. Acts within the secretory pathway to catalyze N-terminal palmitoylation of Hh; this lipid modification is required for the embryonic and larval patterning activities of the Hh signal. Not required for Wg signaling.
Family
Belongs to the membrane-bound acyltransferase family. HHAT subfamily.
Species
Drosophila melanogaster
Length
500 amino acids
Sequence
MSRLPDRSLLTRCEIFVYFGVYIAYIVVGLYKIYGLRDHIVKEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGFIRWKRPRLQCLGFIGVCALALSVNLDWSSMVLLVTLIASYYIVSLLSLKFLVWLLSAGWILCINVMQKNVWWTDRVGYTEYVLVIVTMSWSVLRGCSYSLSKIGAKQEDLTRYSLVQYLGYAMYFPCLTYGPIISYQRFAARREDEVQNWLGFVGGVLRSAIWWLVMQCALHYFYIHYMSRDVRMVEMMDSVFWQHSAGYFMGQFFFLYYVVTYGLGIAFAVQDGIPAPNRPRCIGRIHFYSDMWKYFDEGLYEFLFQNIYAELCGKRSSAAAKFGATALTFAFVFVWHGCYTYVLIWSILNFLCLAAEKVFKTFTAMPEYQRWTQRHLGAVGAQRLYAMLATQLFIPAAFSNVYFIGGQEIGDFLMRGAYLSGVGNYVALCFCSYCFFQCSELLLTKSDGRSKTKTF
Mass
58.1 kDa
Simulated SDS-PAGE
Western blot of rasp recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rasp using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here