Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.

Belongs to the methyltransferase superfamily. L-isoaspartyl/D-aspartyl protein methyltransferase family.

309 amino acids

MNTNTQTEQQIIREETRIDKIIKKRKKKMRAQVLLCPTITAYGRLYCAPRRLHRYNSSSSSSQFLNLNLSRFSGALFFHMEQFQSGTGSSGKRGMVENLKRYGVISSKRVAQVMEALDRGLFVPVGSSAYVDTPVPIGYNATISAPHMHATCLQLLEDKLHPGMRALDVGSGTGYLTGCFALMVGAEGRVVGVDHIPELVDMSIKNIEKSVAASFLKKGSLSLHVGDGRKGWQEFAPYDAIHVGAAASEIPQPLLDQLKPGGRMVIPLGTYFQELKVIDKNEDGSIKVHTETSVRYVPLTSRVEQLGGF

34 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PIMT2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here