May act as a bridging protein that binds pectin and other cell wall polysaccharides. Probably involved in maintaining esterification of pectins (By similarity). May be involved in the specific O-acetylation of cell wall polymers (By similarity).

Belongs to the PC-esterase family. TBL subfamily.

356 amino acids

MGSKDNAISNDSALVLSLLLLLLLPLLHEAAEGCDMFTGRWVKDDSYPLYNSSTCPFIRHEFSCQRNGRPDLDYSTFRWQPLSCKLARFNGLQFLKKNKGKKIMFVGDSLSLNQWQSLACMLHSSVPNSTYTLTTQGSISTYTFKEYGLELKLDRNVYLVDIVREKIGRVLKLDSINDGKNWVEMDTLIFNTWHWWSRRGPAQPWDLIQIGTNVTKDMDRVAAFEIALGTWGKWVDTVLNTKKTRVFFQGISPSHYKGVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLKRALGKISKPVTLLDITMLSLLRKDAHPSVYGLGGRNSSGDCSHWCLSGVPDTWNEILYNYMVE

40.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TBL41 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here