Plays an essential role in the maturation of presomitic mesoderm cells by individual attenuation of both fgf and wnt signaling. Regulates head and somite developmen. Inhibits both wnt and fgf signaling through the regulation of protein maturation and cell surface transportation of their receptors within the endoplasmic reticulum.

Belongs to the shisa family.

232 amino acids

MRLLGCFFLIFLTWGSARAQGEYCHGWLDSAGNYQAGFQCPEDFDTADANICCGSCALRYCCAAADARLEQGSCTNHRELEKSGVSAQPVYVPFLIVGSIFIAFIIVGSLVAVYCCTCLRPKQTSQQPMRFTLRSYPPETLPMILTSGNLRTPSRQSSTATSSTSTGGSVRRLSSSRADPGYLVSSPPPPYSSAHSIHLNPSSTFLVSNQYFPYPLQPEAIANKSCPDFRQS

25.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make shisa3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here