Transcriptional repressor (By similarity). Regulates mesoderm versus endoderm differentiation during gastrulation to regulate kidney versus vascular cell fate. Acts upstream of pax2a in kidney development and functions in glomerular maturation, after podocyte specification.

Belongs to the Odd C2H2-type zinc-finger protein family.

264 amino acids

MGSKTLPAPVPLHPSLQLANYSFLQTSNGLHLPADHMPSIYSFSALHAVHLHQWTLGYPPFTLPRCTFSKLPGLVDARFPLPSIPLFPHLVQPAKQESSGPGSGASSKSKPRFDFANLAAAATQDDALKAEDLSTNNGHVRSPSLGCLLDVAKLSSPERKPSRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQVKELKPAKIK

29.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make osr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here