Expression of the kil gene induces dramatic morphological changes in the host cell, which becomes enlarged and predominantly spherical and possibly dies. These changes might involved a direct or indirect interaction with host actin-like protein MreB.

74 amino acids

MARNIKMATDAQNWLQARGSHVNESYLGVARPILEITYPPVELVKNAVRIMEHKSGVARSVWTARLNGCQIIWR

8.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make kil using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here