Acts as cargo receptor necessary for the transportation of gurken (grk) to a transitional endoplasmic reticulum (tER) site and promotes its incorporation into coat protein complex II (COPII) vesicles. Associated with gurken, produces a signal received by torpedo resulting in a signaling pathway that first establishes posterior follicle cell fates and normal localization of the anterior and posterior determinants, later they act in a signaling event inducing dorsal follicle cell fates and regulating the dorsal-ventral pattern of egg and embryo.

Belongs to the cornichon family.

144 amino acids

MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST

16.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cni using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here