About Products Protein Database Contact

Protein expression services for cni | Protein cornichon

Description
Acts as cargo receptor necessary for the transportation of gurken (grk) to a transitional endoplasmic reticulum (tER) site and promotes its incorporation into coat protein complex II (COPII) vesicles. Associated with gurken, produces a signal received by torpedo resulting in a signaling pathway that first establishes posterior follicle cell fates and normal localization of the anterior and posterior determinants, later they act in a signaling event inducing dorsal follicle cell fates and regulating the dorsal-ventral pattern of egg and embryo.
Family
Belongs to the cornichon family.
Species
Drosophila melanogaster
Length
144 amino acids
Sequence
MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST
Mass
16.9 kDa
Simulated SDS-PAGE
Western blot of cni recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make cni using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here