Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) (By similarity). Plays an important role in the proper development of cranial nerves by facilitating the secretion of HBEGF.

Belongs to the cornichon family.

160 amino acids

MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYCIHGLFCLMFLCAAEWVTLGLNLPLLLYHLWRYFHRPSDGSEGLFDAVSIMDADILGYCQKEAWCKLAFYLLSFFYYLYSMVYTLVSF

18.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CNIH2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here